Lineage for d3h1hq2 (3h1h Q:196-241)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631158Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) (S)
  5. 2631203Family f.23.11.0: automated matches [232790] (1 protein)
    not a true family
  6. 2631204Protein automated matches [232791] (3 species)
    not a true protein
  7. 2631209Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries)
  8. 2631223Domain d3h1hq2: 3h1h Q:196-241 [246433]
    Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_
    automated match to d3l70d2
    complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hq2

PDB Entry: 3h1h (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (Q:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d3h1hq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1hq2 f.23.11.0 (Q:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk

SCOPe Domain Coordinates for d3h1hq2:

Click to download the PDB-style file with coordinates for d3h1hq2.
(The format of our PDB-style files is described here.)

Timeline for d3h1hq2: