![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins) |
![]() | Protein automated matches [232767] (3 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries) |
![]() | Domain d3h1hq1: 3h1h Q:1-195 [246432] Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_ automated match to d3l71d1 complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq |
PDB Entry: 3h1h (more details), 3.16 Å
SCOPe Domain Sequences for d3h1hq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1hq1 a.3.1.3 (Q:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms qiakdvctflrwaae
Timeline for d3h1hq1: