Lineage for d3h1ho2 (3h1h O:236-439)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611057Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2611058Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2611366Family d.185.1.0: automated matches [232765] (1 protein)
    not a true family
  6. 2611367Protein automated matches [232766] (2 species)
    not a true protein
  7. 2611368Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)
  8. 2611423Domain d3h1ho2: 3h1h O:236-439 [246429]
    Other proteins in same PDB: d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_
    automated match to d3l71b2
    complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1ho2

PDB Entry: 3h1h (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (O:) Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial

SCOPe Domain Sequences for d3h1ho2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1ho2 d.185.1.0 (O:236-439) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
katywggeireqnghslvhaavvtegaavgsaeanafsvlqhvlgagplikrgssvtskl
yqgvakattqpfdasafnvnysdsglfgfytisqaahageviraamnqlkaaaqggvtee
dvtkaknqlkatylmsvetaqgllneigseallsgthtapsvvaqkidsvtsadvvnaak
kfvsgkksmaasgdlgstpfldel

SCOPe Domain Coordinates for d3h1ho2:

Click to download the PDB-style file with coordinates for d3h1ho2.
(The format of our PDB-style files is described here.)

Timeline for d3h1ho2: