SCOPe 2.07: Domain d3h1hn2: 3h1h N:234-444

Lineage for d3h1hn2 (3h1h N:234-444)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.0: automated matches [232765] (1 protein)
   not a true family

6. Protein automated matches [232766] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)

8. Domain d3h1hn2: 3h1h N:234-444 [246427]
   Other proteins in same PDB: d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_
   automated match to d3l71a2
   complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hn2

PDB Entry: 3h1h, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (N:) Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial

SCOPe Domain Sequences for d3h1hn2:

Sequence; same for both SEQRES and ATOM records:

>d3h1hn2 d.185.1.0 (N:234-444) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
crftgseirarddalpvahvalavegpgwadpdnvvlhvanaiigrydrtfgggkhlssr
laalavehklchsfqtfntsysdtglfgfhfvadplsiddmmfcaqgewmrlctsttese
vkraknhlrsamvaqldgttpvcetigshllnygrrisleewdsrisavdarmvrdvcsk
yiydkcpalaavgpieqlldynrirsgmywi

Timeline for d3h1hn2:

• d3h1hn2 first appeared in SCOPe 2.04
  
• d3h1hn2 appears in SCOPe 2.06
  
• d3h1hn2 appears in the current release, SCOPe 2.08