SCOPe 2.04: Domain d3h1hd2: 3h1h D:196-241

Lineage for d3h1hd2 (3h1h D:196-241)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.0: automated matches [232790] (1 protein)
   not a true family

6. Protein automated matches [232791] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries)

8. Domain d3h1hd2: 3h1h D:196-241 [246421]
   Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd1, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_
   automated match to d3l70d2
   complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hd2

PDB Entry: 3h1h, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d3h1hd2:

Sequence; same for both SEQRES and ATOM records:

>d3h1hd2 f.23.11.0 (D:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk

Timeline for d3h1hd2:

• d3h1hd2 is new in SCOPe 2.04-stable
  
• d3h1hd2 appears in SCOPe 2.05
  
• d3h1hd2 appears in the current release, SCOPe 2.07