SCOPe 2.06: Domain d3h1hd1: 3h1h D:1-195

Lineage for d3h1hd1 (3h1h D:1-195)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein automated matches [232767] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries)

8. Domain d3h1hd1: 3h1h D:1-195 [246420]
   Other proteins in same PDB: d3h1ha1, d3h1ha2, d3h1hb1, d3h1hb2, d3h1hc1, d3h1hc2, d3h1hd2, d3h1he1, d3h1he2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hn1, d3h1hn2, d3h1ho1, d3h1ho2, d3h1hp1, d3h1hp2, d3h1hq2, d3h1hr1, d3h1hr2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_
   automated match to d3l71d1
   complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq

Details for d3h1hd1

PDB Entry: 3h1h, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d3h1hd1:

Sequence; same for both SEQRES and ATOM records:

>d3h1hd1 a.3.1.3 (D:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae
akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar
hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms
qiakdvctflrwaae

Timeline for d3h1hd1:

• d3h1hd1 first appeared in SCOPe 2.04
  
• d3h1hd1 appears in SCOPe 2.05
  
• d3h1hd1 appears in SCOPe 2.07
  
• d3h1hd1 appears in the current release, SCOPe 2.08