| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
| Protein automated matches [232766] (2 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries) |
| Domain d3h1ha2: 3h1h A:234-444 [246415] Other proteins in same PDB: d3h1hc1, d3h1hc2, d3h1hd1, d3h1hd2, d3h1hf_, d3h1hg_, d3h1hh_, d3h1hj_, d3h1hp1, d3h1hp2, d3h1hq1, d3h1hq2, d3h1hs_, d3h1ht_, d3h1hu_, d3h1hw_ automated match to d3l71a2 complexed with bog, cdl, fes, gol, hec, hem, pee, unl, uq |
PDB Entry: 3h1h (more details), 3.16 Å
SCOPe Domain Sequences for d3h1ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1ha2 d.185.1.0 (A:234-444) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
crftgseirarddalpvahvalavegpgwadpdnvvlhvanaiigrydrtfgggkhlssr
laalavehklchsfqtfntsysdtglfgfhfvadplsiddmmfcaqgewmrlctsttese
vkraknhlrsamvaqldgttpvcetigshllnygrrisleewdsrisavdarmvrdvcsk
yiydkcpalaavgpieqlldynrirsgmywi
Timeline for d3h1ha2: