Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (54 species) not a true protein |
Species Streptomyces avermitilis [TaxId:33903] [255855] (1 PDB entry) |
Domain d3h0ub_: 3h0u B: [246407] Other proteins in same PDB: d3h0ua2 automated match to d3swxa_ complexed with dms, na |
PDB Entry: 3h0u (more details), 1.5 Å
SCOPe Domain Sequences for d3h0ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h0ub_ c.14.1.0 (B:) automated matches {Streptomyces avermitilis [TaxId: 33903]} yetikarldgtvlsatfnappmnligpevvrdlvalleelahptaprvvifdsadadfff phvdmtkvpeytaeaakaggpgdaslgmlfrklsqlpavtiaklrgrargagsefllacd mrfasrenailgqpevgigappgagaiqhltrllgrgraleavltssdfdadlaerygwv nravpdaeldefvagiaarmsgfprdaliaaksainaislpapaevradaalfqqlvrge kvqqrtaelfkqgfqtrgateldlgdalghlkav
Timeline for d3h0ub_: