Lineage for d1c1ab1 (1c1a B:217-268)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784433Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) (S)
  5. 2784434Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
    Pfam PF00552, Pfam PF18103
  6. 2784435Protein DNA-binding domain of retroviral integrase [50124] (4 species)
  7. 2784459Species Rous sarcoma virus RSV [TaxId:11886] [50126] (2 PDB entries)
  8. 2784465Domain d1c1ab1: 1c1a B:217-268 [24640]
    Other proteins in same PDB: d1c1aa2, d1c1ab2

Details for d1c1ab1

PDB Entry: 1c1a (more details), 3.1 Å

PDB Description: crystal structure of rsv two-domain integrase
PDB Compounds: (B:) rsv integrase

SCOPe Domain Sequences for d1c1ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1ab1 b.34.7.1 (B:217-268) DNA-binding domain of retroviral integrase {Rous sarcoma virus RSV [TaxId: 11886]}
vltegppvkirietgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpd

SCOPe Domain Coordinates for d1c1ab1:

Click to download the PDB-style file with coordinates for d1c1ab1.
(The format of our PDB-style files is described here.)

Timeline for d1c1ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1ab2