| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (158 species) not a true protein |
| Species Halomonas elongata [TaxId:2746] [255854] (3 PDB entries) |
| Domain d3gyyd_: 3gyy D: [246393] automated match to d2ceya_ complexed with zn |
PDB Entry: 3gyy (more details), 2.2 Å
SCOPe Domain Sequences for d3gyyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gyyd_ c.94.1.0 (D:) automated matches {Halomonas elongata [TaxId: 2746]}
dnwryaheeyegdvqdvfaqafkgyvednsdhtvqvyrfgelgesddimeqtqngilqfv
nqspgftgslipsaqiffipylmptdmdtvleffdeskainemfpklyaehglellkmyp
egemvvtadepitspedfdnkkirtmtnpllaetykafgatptplpwgevygglqtgiid
gqenpifwiesgglyevspnltftshgwfttammanqdfyeglseedqqlvqdaadaayd
htiehikglseeslekikaasdevtvtrlndeqiqafkerapqveekfiemtgeqgqell
dqfkadlkavq
Timeline for d3gyyd_: