Lineage for d3gyyd_ (3gyy D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2522948Species Halomonas elongata [TaxId:2746] [255854] (3 PDB entries)
  8. 2522956Domain d3gyyd_: 3gyy D: [246393]
    automated match to d2ceya_
    complexed with zn

Details for d3gyyd_

PDB Entry: 3gyy (more details), 2.2 Å

PDB Description: The ectoine binding protein of the TeaABC TRAP transporter TeaA in the Apo-State
PDB Compounds: (D:) periplasmic substrate binding protein

SCOPe Domain Sequences for d3gyyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gyyd_ c.94.1.0 (D:) automated matches {Halomonas elongata [TaxId: 2746]}
dnwryaheeyegdvqdvfaqafkgyvednsdhtvqvyrfgelgesddimeqtqngilqfv
nqspgftgslipsaqiffipylmptdmdtvleffdeskainemfpklyaehglellkmyp
egemvvtadepitspedfdnkkirtmtnpllaetykafgatptplpwgevygglqtgiid
gqenpifwiesgglyevspnltftshgwfttammanqdfyeglseedqqlvqdaadaayd
htiehikglseeslekikaasdevtvtrlndeqiqafkerapqveekfiemtgeqgqell
dqfkadlkavq

SCOPe Domain Coordinates for d3gyyd_:

Click to download the PDB-style file with coordinates for d3gyyd_.
(The format of our PDB-style files is described here.)

Timeline for d3gyyd_: