Lineage for d1c1aa1 (1c1a A:217-272)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58563Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (1 family) (S)
  5. 58564Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
  6. 58565Protein DNA-binding domain of retroviral integrase [50124] (3 species)
  7. 58575Species Rous sarcoma virus (RSV, avian sarcoma virus) [50126] (2 PDB entries)
  8. 58580Domain d1c1aa1: 1c1a A:217-272 [24639]
    Other proteins in same PDB: d1c1aa2, d1c1ab2

Details for d1c1aa1

PDB Entry: 1c1a (more details), 3.1 Å

PDB Description: crystal structure of rsv two-domain integrase

SCOP Domain Sequences for d1c1aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1aa1 b.34.7.1 (A:217-272) DNA-binding domain of retroviral integrase {Rous sarcoma virus (RSV, avian sarcoma virus)}
vltegppvkirietgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpditqk

SCOP Domain Coordinates for d1c1aa1:

Click to download the PDB-style file with coordinates for d1c1aa1.
(The format of our PDB-style files is described here.)

Timeline for d1c1aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1aa2