Lineage for d3gxna2 (3gxn A:324-421)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804047Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1804371Protein Melibiase [75020] (4 species)
  7. 1804375Species Human (Homo sapiens) [TaxId:9606] [101919] (17 PDB entries)
    alpha-galactosidase A
  8. 1804404Domain d3gxna2: 3gxn A:324-421 [246385]
    Other proteins in same PDB: d3gxna1, d3gxnb1
    automated match to d3hg3a2
    complexed with so4

Details for d3gxna2

PDB Entry: 3gxn (more details), 3.01 Å

PDB Description: crystal structure of apo alpha-galactosidase a at ph 4.5
PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d3gxna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gxna2 b.71.1.1 (A:324-421) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentm

SCOPe Domain Coordinates for d3gxna2:

Click to download the PDB-style file with coordinates for d3gxna2.
(The format of our PDB-style files is described here.)

Timeline for d3gxna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gxna1