Lineage for d3gxac_ (3gxa C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163916Species Neisseria meningitidis [TaxId:487] [232610] (2 PDB entries)
  8. 2163925Domain d3gxac_: 3gxa C: [246380]
    automated match to d3ir1b_
    complexed with met, so4

Details for d3gxac_

PDB Entry: 3gxa (more details), 2.25 Å

PDB Description: Crystal structure of GNA1946
PDB Compounds: (C:) Outer membrane lipoprotein GNA1946

SCOPe Domain Sequences for d3gxac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gxac_ c.94.1.0 (C:) automated matches {Neisseria meningitidis [TaxId: 487]}
keivfgttvgdfgdmvkeqiqpelekkgytvklveftdyvrpnlalaegeldinvfqhkp
ylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmld
elgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgm
kltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaawn
egaa

SCOPe Domain Coordinates for d3gxac_:

Click to download the PDB-style file with coordinates for d3gxac_.
(The format of our PDB-style files is described here.)

Timeline for d3gxac_: