![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:487] [232610] (4 PDB entries) |
![]() | Domain d3gxab_: 3gxa B: [246379] automated match to d3ir1b_ complexed with met, so4 |
PDB Entry: 3gxa (more details), 2.25 Å
SCOPe Domain Sequences for d3gxab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gxab_ c.94.1.0 (B:) automated matches {Neisseria meningitidis [TaxId: 487]} keivfgttvgdfgdmvkeqiqpelekkgytvklveftdyvrpnlalaegeldinvfqhkp ylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmld elgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgm kltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaaw
Timeline for d3gxab_: