Lineage for d3gwke1 (3gwk E:4-97)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705332Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 2705346Family a.25.3.0: automated matches [193224] (1 protein)
    not a true family
  6. 2705347Protein automated matches [193225] (4 species)
    not a true protein
  7. 2705388Species Streptococcus agalactiae [TaxId:208435] [232336] (2 PDB entries)
  8. 2705390Domain d3gwke1: 3gwk E:4-97 [246377]
    Other proteins in same PDB: d3gwkc2, d3gwke2
    automated match to d3gvmc_
    complexed with so4

Details for d3gwke1

PDB Entry: 3gwk (more details), 1.3 Å

PDB Description: Structure of the homodimeric WXG-100 family protein from Streptococcus agalactiae
PDB Compounds: (E:) Putative uncharacterized protein SAG1039

SCOPe Domain Sequences for d3gwke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gwke1 a.25.3.0 (E:4-97) automated matches {Streptococcus agalactiae [TaxId: 208435]}
qikltpeelrssaqkytagsqqvtevlnlltqeqavidenwdgstfdsfeaqfnelspki
tefaqlledinqqllkvadiieqtdadiasqisg

SCOPe Domain Coordinates for d3gwke1:

Click to download the PDB-style file with coordinates for d3gwke1.
(The format of our PDB-style files is described here.)

Timeline for d3gwke1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gwke2