![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) ![]() (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
![]() | Family a.25.3.0: automated matches [193224] (1 protein) not a true family |
![]() | Protein automated matches [193225] (4 species) not a true protein |
![]() | Species Streptococcus agalactiae [TaxId:208435] [232336] (2 PDB entries) |
![]() | Domain d3gwke1: 3gwk E:4-97 [246377] Other proteins in same PDB: d3gwkc2, d3gwke2 automated match to d3gvmc_ complexed with so4 |
PDB Entry: 3gwk (more details), 1.3 Å
SCOPe Domain Sequences for d3gwke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gwke1 a.25.3.0 (E:4-97) automated matches {Streptococcus agalactiae [TaxId: 208435]} qikltpeelrssaqkytagsqqvtevlnlltqeqavidenwdgstfdsfeaqfnelspki tefaqlledinqqllkvadiieqtdadiasqisg
Timeline for d3gwke1: