Lineage for d1c0mc1 (1c0m C:217-270)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311081Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) (S)
  5. 1311082Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
  6. 1311083Protein DNA-binding domain of retroviral integrase [50124] (3 species)
  7. 1311093Species Rous sarcoma virus RSV [TaxId:11886] [50126] (2 PDB entries)
  8. 1311096Domain d1c0mc1: 1c0m C:217-270 [24637]
    Other proteins in same PDB: d1c0ma2, d1c0mb2, d1c0mc2, d1c0md2

Details for d1c0mc1

PDB Entry: 1c0m (more details), 2.53 Å

PDB Description: crystal structure of rsv two-domain integrase
PDB Compounds: (C:) protein (integrase)

SCOPe Domain Sequences for d1c0mc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0mc1 b.34.7.1 (C:217-270) DNA-binding domain of retroviral integrase {Rous sarcoma virus RSV [TaxId: 11886]}
vltegppvkirietgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdit

SCOPe Domain Coordinates for d1c0mc1:

Click to download the PDB-style file with coordinates for d1c0mc1.
(The format of our PDB-style files is described here.)

Timeline for d1c0mc1: