SCOPe 2.08: Domain d3gtab_: 3gta B:

Lineage for d3gtab_ (3gta B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103631] (8 PDB entries)
   Uniprot Q96CA5 78-159

8. Domain d3gtab_: 3gta B: [246360]
   automated match to d1oxnb_
   complexed with 851, btb, edo, li, zn

Details for d3gtab_

PDB Entry: 3gta, 1.7 Å

PDB Description: structure of an ml-iap/xiap chimera bound to a peptidomimetic

PDB Compounds: (B:) Baculoviral IAP repeat-containing 7

SCOPe Domain Sequences for d3gtab_:

Sequence; same for both SEQRES and ATOM records:

>d3gtab_ g.52.1.1 (B:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnihlt

Timeline for d3gtab_:

• d3gtab_ first appeared in SCOPe 2.04
  
• d3gtab_ appears in SCOPe 2.07