Lineage for d3gt9b_ (3gt9 B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642738Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2642739Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2642740Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2642833Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)
  7. 2642834Species Human (Homo sapiens) [TaxId:9606] [103631] (8 PDB entries)
    Uniprot Q96CA5 78-159
  8. 2642845Domain d3gt9b_: 3gt9 B: [246358]
    automated match to d1oxnb_
    complexed with 516, zn

Details for d3gt9b_

PDB Entry: 3gt9 (more details), 1.7 Å

PDB Description: structure of an ml-iap/xiap chimera bound to a peptidomimetic
PDB Compounds: (B:) Baculoviral IAP repeat-containing 7

SCOPe Domain Sequences for d3gt9b_:

Sequence, based on SEQRES records: (download)

>d3gt9b_ g.52.1.1 (B:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnihlt

Sequence, based on observed residues (ATOM records): (download)

>d3gt9b_ g.52.1.1 (B:) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtdkvrcffcygglqswkrgddp
wtehakwfpgcqfllrskgqeyinnihlt

SCOPe Domain Coordinates for d3gt9b_:

Click to download the PDB-style file with coordinates for d3gt9b_.
(The format of our PDB-style files is described here.)

Timeline for d3gt9b_: