Class a: All alpha proteins [46456] (289 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries) |
Domain d3gq5a2: 3gq5 A:135-216 [246351] Other proteins in same PDB: d3gq5a1, d3gq5a3 automated match to d1r2za1 protein/DNA complex; complexed with gol, zn |
PDB Entry: 3gq5 (more details), 1.9 Å
SCOPe Domain Sequences for d3gq5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gq5a2 a.156.1.2 (A:135-216) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} gpeplspafspavlaeravktkrsvkallldctvvagfgniyvdeslfragilpgrpaas lsskeierlheemvatigeavm
Timeline for d3gq5a2: