SCOPe 2.06: Domain d3gq5a2: 3gq5 A:135-216

Lineage for d3gq5a2 (3gq5 A:135-216)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (4 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
   contains 4 helices in the core

6. Protein DNA repair protein MutM (Fpg) [81620] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries)

8. Domain d3gq5a2: 3gq5 A:135-216 [246351]
   Other proteins in same PDB: d3gq5a1, d3gq5a3
   automated match to d1r2za1
   protein/DNA complex; complexed with gol, zn

Details for d3gq5a2

PDB Entry: 3gq5, 1.9 Å

PDB Description: sequence-matched mutm interrogation complex 5 (ic5)

PDB Compounds: (A:) DNA glycosylase

SCOPe Domain Sequences for d3gq5a2:

Sequence; same for both SEQRES and ATOM records:

>d3gq5a2 a.156.1.2 (A:135-216) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldctvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavm

Timeline for d3gq5a2:

• d3gq5a2 first appeared in SCOPe 2.04
  
• d3gq5a2 appears in SCOPe 2.05
  
• d3gq5a2 appears in SCOPe 2.07
  
• d3gq5a2 appears in the current release, SCOPe 2.08