| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) ![]() |
| Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein) |
| Protein DNA-binding domain of retroviral integrase [50124] (3 species) |
| Species Rous sarcoma virus RSV [TaxId:11886] [50126] (2 PDB entries) |
| Domain d1c0ma1: 1c0m A:217-269 [24635] Other proteins in same PDB: d1c0ma2, d1c0mb2, d1c0mc2, d1c0md2 |
PDB Entry: 1c0m (more details), 2.53 Å
SCOPe Domain Sequences for d1c0ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0ma1 b.34.7.1 (A:217-269) DNA-binding domain of retroviral integrase {Rous sarcoma virus RSV [TaxId: 11886]}
vltegppvkirietgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdi
Timeline for d1c0ma1: