Class g: Small proteins [56992] (92 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins) |
Protein DNA repair protein MutM (Fpg) [81622] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81613] (23 PDB entries) |
Domain d3gq4a3: 3gq4 A:229-274 [246349] Other proteins in same PDB: d3gq4a1, d3gq4a2 automated match to d1r2za3 protein/DNA complex; complexed with gol, zn |
PDB Entry: 3gq4 (more details), 1.7 Å
SCOPe Domain Sequences for d3gq4a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gq4a3 g.39.1.8 (A:229-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} qgeagtfqhhlyvygrqgnpckrcgtpiektvvagrgthycprcqr
Timeline for d3gq4a3: