Class a: All alpha proteins [46456] (289 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries) |
Domain d3gpxa2: 3gpx A:135-216 [246342] Other proteins in same PDB: d3gpxa1, d3gpxa3 automated match to d1l1ta1 protein/DNA complex; complexed with zn |
PDB Entry: 3gpx (more details), 1.78 Å
SCOPe Domain Sequences for d3gpxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gpxa2 a.156.1.2 (A:135-216) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} gpeplspafspavlaeravktkrsvkallldctvvagfgniyvdeslfragilpgrpaas lsskeierlheemvatigeavm
Timeline for d3gpxa2: