Lineage for d3gpua3 (3gpu A:239-274)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705142Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1705143Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1705529Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. Species Bacillus stearothermophilus [TaxId:1422] [81613] (23 PDB entries)
  8. 1705532Domain d3gpua3: 3gpu A:239-274 [246340]
    Other proteins in same PDB: d3gpua1, d3gpua2
    automated match to d1l1ta3
    protein/DNA complex; complexed with zn

Details for d3gpua3

PDB Entry: 3gpu (more details), 1.62 Å

PDB Description: mutm encountering an intrahelical 8-oxoguanine (oxog) lesion in ec4- loop deletion complex
PDB Compounds: (A:) DNA glycosylase

SCOPe Domain Sequences for d3gpua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gpua3 g.39.1.8 (A:239-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
lyvygrqgnpckrcgtpiektvvagrgthycprcqr

SCOPe Domain Coordinates for d3gpua3:

Click to download the PDB-style file with coordinates for d3gpua3.
(The format of our PDB-style files is described here.)

Timeline for d3gpua3: