Lineage for d1qmcb_ (1qmc B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537317Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) (S)
  5. 1537318Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
  6. 1537319Protein DNA-binding domain of retroviral integrase [50124] (3 species)
  7. 1537320Species Human immunodeficiency virus type 1 [TaxId:11676] [50125] (4 PDB entries)
  8. 1537328Domain d1qmcb_: 1qmc B: [24634]

Details for d1qmcb_

PDB Entry: 1qmc (more details)

PDB Description: c-terminal dna-binding domain of hiv-1 integrase, nmr, 42 structures
PDB Compounds: (B:) hiv-1 integrase

SCOPe Domain Sequences for d1qmcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmcb_ b.34.7.1 (B:) DNA-binding domain of retroviral integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
miqnfrvyyrdsrnplwkgpakllwkgegavviqdnsdikvvprrkakiird

SCOPe Domain Coordinates for d1qmcb_:

Click to download the PDB-style file with coordinates for d1qmcb_.
(The format of our PDB-style files is described here.)

Timeline for d1qmcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qmca_