Lineage for d1qmcb1 (1qmc B:220-270)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784433Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) (S)
  5. 2784434Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
    Pfam PF00552, Pfam PF18103
  6. 2784435Protein DNA-binding domain of retroviral integrase [50124] (4 species)
  7. 2784436Species Human immunodeficiency virus type 1 [TaxId:11676] [50125] (8 PDB entries)
  8. 2784447Domain d1qmcb1: 1qmc B:220-270 [24634]
    Other proteins in same PDB: d1qmca2, d1qmcb2

Details for d1qmcb1

PDB Entry: 1qmc (more details)

PDB Description: c-terminal dna-binding domain of hiv-1 integrase, nmr, 42 structures
PDB Compounds: (B:) hiv-1 integrase

SCOPe Domain Sequences for d1qmcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmcb1 b.34.7.1 (B:220-270) DNA-binding domain of retroviral integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
iqnfrvyyrdsrnplwkgpakllwkgegavviqdnsdikvvprrkakiird

SCOPe Domain Coordinates for d1qmcb1:

Click to download the PDB-style file with coordinates for d1qmcb1.
(The format of our PDB-style files is described here.)

Timeline for d1qmcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qmcb2