Lineage for d3goub_ (3gou B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687071Species Dog (Canis familiaris) [TaxId:9615] [158218] (3 PDB entries)
  8. 2687073Domain d3goub_: 3gou B: [246330]
    Other proteins in same PDB: d3goua_, d3gouc_
    automated match to d3pelb_
    complexed with hem

Details for d3goub_

PDB Entry: 3gou (more details), 3 Å

PDB Description: Crystal structure of dog (Canis familiaris) hemoglobin
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3goub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3goub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Dog (Canis familiaris) [TaxId: 9615]}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d3goub_:

Click to download the PDB-style file with coordinates for d3goub_.
(The format of our PDB-style files is described here.)

Timeline for d3goub_: