| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) ![]() |
| Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein) Pfam PF00552, Pfam PF18103 |
| Protein DNA-binding domain of retroviral integrase [50124] (4 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [50125] (8 PDB entries) |
| Domain d1qmca1: 1qmc A:220-270 [24633] Other proteins in same PDB: d1qmca2, d1qmcb2 |
PDB Entry: 1qmc (more details)
SCOPe Domain Sequences for d1qmca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qmca1 b.34.7.1 (A:220-270) DNA-binding domain of retroviral integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
iqnfrvyyrdsrnplwkgpakllwkgegavviqdnsdikvvprrkakiird
Timeline for d1qmca1: