SCOPe 2.08: Domain d3glxa3: 3glx A:148-226

Lineage for d3glxa3 (3glx A:148-226)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.0: automated matches [254294] (1 protein)
   not a true family

6. Protein automated matches [254678] (2 species)
   not a true protein

7. Species Corynebacterium diphtheriae [TaxId:1717] [255851] (1 PDB entry)

8. Domain d3glxa3: 3glx A:148-226 [246328]
   Other proteins in same PDB: d3glxa1, d3glxa2
   automated match to d2dtra3
   protein/DNA complex; complexed with ni, po4

Details for d3glxa3

PDB Entry: 3glx, 1.85 Å

PDB Description: crystal structure analysis of the dtxr(e175k) complexed with ni(ii)

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d3glxa3:

Sequence, based on SEQRES records:

>d3glxa3 b.34.1.0 (A:148-226) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvktdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtirieel

Sequence, based on observed residues (ATOM records):

>d3glxa3 b.34.1.0 (A:148-226) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvktdqftqlldadirvgseveivdrdhitlshkd
vellddlahtirieel

Timeline for d3glxa3:

• d3glxa3 first appeared in SCOPe 2.04
  
• d3glxa3 appears in SCOPe 2.07