SCOPe 2.06: Domain d3glxa2: 3glx A:65-140

Lineage for d3glxa2 (3glx A:65-140)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.0: automated matches [254293] (1 protein)
   not a true family

6. Protein automated matches [254677] (1 species)
   not a true protein

7. Species Corynebacterium diphtheriae [TaxId:1717] [255850] (1 PDB entry)

8. Domain d3glxa2: 3glx A:65-140 [246327]
   Other proteins in same PDB: d3glxa1, d3glxa3
   automated match to d2dtra2
   protein/DNA complex; complexed with ni, po4

Details for d3glxa2

PDB Entry: 3glx, 1.85 Å

PDB Description: crystal structure analysis of the dtxr(e175k) complexed with ni(ii)

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d3glxa2:

Sequence; same for both SEQRES and ATOM records:

>d3glxa2 a.76.1.0 (A:65-140) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

Timeline for d3glxa2:

• d3glxa2 first appeared in SCOPe 2.04
  
• d3glxa2 appears in SCOPe 2.05
  
• d3glxa2 appears in SCOPe 2.07
  
• d3glxa2 appears in the current release, SCOPe 2.08