![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) ![]() automatically mapped to Pfam PF02742 |
![]() | Family a.76.1.0: automated matches [254293] (1 protein) not a true family |
![]() | Protein automated matches [254677] (2 species) not a true protein |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [255850] (1 PDB entry) |
![]() | Domain d3glxa2: 3glx A:65-140 [246327] Other proteins in same PDB: d3glxa1, d3glxa3 automated match to d2dtra2 protein/DNA complex; complexed with ni, po4 |
PDB Entry: 3glx (more details), 1.85 Å
SCOPe Domain Sequences for d3glxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3glxa2 a.76.1.0 (A:65-140) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs rspfgnpipgldelgv
Timeline for d3glxa2: