Lineage for d3glxa2 (3glx A:65-140)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718817Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2718818Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2718921Family a.76.1.0: automated matches [254293] (1 protein)
    not a true family
  6. 2718922Protein automated matches [254677] (2 species)
    not a true protein
  7. 2718928Species Corynebacterium diphtheriae [TaxId:1717] [255850] (1 PDB entry)
  8. 2718929Domain d3glxa2: 3glx A:65-140 [246327]
    Other proteins in same PDB: d3glxa1, d3glxa3
    automated match to d2dtra2
    protein/DNA complex; complexed with ni, po4

Details for d3glxa2

PDB Entry: 3glx (more details), 1.85 Å

PDB Description: crystal structure analysis of the dtxr(e175k) complexed with ni(ii)
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d3glxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3glxa2 a.76.1.0 (A:65-140) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

SCOPe Domain Coordinates for d3glxa2:

Click to download the PDB-style file with coordinates for d3glxa2.
(The format of our PDB-style files is described here.)

Timeline for d3glxa2: