![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [255849] (1 PDB entry) |
![]() | Domain d3glxa1: 3glx A:6-64 [246326] Other proteins in same PDB: d3glxa2, d3glxa3 automated match to d2dtra1 protein/DNA complex; complexed with ni, po4 |
PDB Entry: 3glx (more details), 1.85 Å
SCOPe Domain Sequences for d3glxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3glxa1 a.4.5.0 (A:6-64) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} dttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslqm
Timeline for d3glxa1: