Lineage for d3glwa_ (3glw A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551753Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 2551754Superfamily d.39.1: DLC [54648] (1 family) (S)
    automatically mapped to Pfam PF01221
  5. 2551755Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 2551756Protein Dynein light chain 1 (DLC1) [54650] (3 species)
    synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase
  7. 2551757Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (14 PDB entries)
  8. 2551785Domain d3glwa_: 3glw A: [246325]
    automated match to d1rhwa_

Details for d3glwa_

PDB Entry: 3glw (more details), 3.15 Å

PDB Description: Quaternary Structure of Drosophila melanogaster IC/Tctex-1/LC8; Allosteric Interactions of Dynein Light Chains with Dynein Intermediate Chain
PDB Compounds: (A:) Dynein light chain 1, cytoplasmic

SCOPe Domain Sequences for d3glwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3glwa_ d.39.1.1 (A:) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfg
syvthetrhfiyfylgqvaillfksg

SCOPe Domain Coordinates for d3glwa_:

Click to download the PDB-style file with coordinates for d3glwa_.
(The format of our PDB-style files is described here.)

Timeline for d3glwa_: