SCOPe 2.06: Domain d3giqa3: 3giq A:419-478

Lineage for d3giqa3 (3giq A:419-478)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.0: automated matches [254292] (1 protein)
   not a true family

6. Protein automated matches [254676] (1 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:518] [255847] (2 PDB entries)

8. Domain d3giqa3: 3giq A:419-478 [246312]
   Other proteins in same PDB: d3giqa2, d3giqb2
   automated match to d1rk6a2
   complexed with g01, zn

Details for d3giqa3

PDB Entry: 3giq, 1.8 Å

PDB Description: Crystal structure of N-acyl-D-Glutamate Deacylase from Bordetella Bronchiseptica complexed with zinc and phosphonate inhibitor, a mimic of the reaction tetrahedral intermediate.

PDB Compounds: (A:) N-acyl-D-glutamate deacylase

SCOPe Domain Sequences for d3giqa3:

Sequence; same for both SEQRES and ATOM records:

>d3giqa3 b.92.1.0 (A:419-478) automated matches {Bordetella bronchiseptica [TaxId: 518]}
vlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlra

Timeline for d3giqa3:

• d3giqa3 first appeared in SCOPe 2.04
  
• d3giqa3 appears in SCOPe 2.05
  
• d3giqa3 appears in SCOPe 2.07
  
• d3giqa3 appears in the current release, SCOPe 2.08