Lineage for d3giqa2 (3giq A:61-418)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2834067Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2834068Protein automated matches [190150] (36 species)
    not a true protein
  7. 2834104Species Bordetella bronchiseptica [TaxId:518] [255848] (2 PDB entries)
  8. 2834107Domain d3giqa2: 3giq A:61-418 [246311]
    Other proteins in same PDB: d3giqa1, d3giqa3, d3giqb1, d3giqb3
    automated match to d1rk6a3
    complexed with g01, zn

Details for d3giqa2

PDB Entry: 3giq (more details), 1.8 Å

PDB Description: Crystal structure of N-acyl-D-Glutamate Deacylase from Bordetella Bronchiseptica complexed with zinc and phosphonate inhibitor, a mimic of the reaction tetrahedral intermediate.
PDB Compounds: (A:) N-acyl-D-glutamate deacylase

SCOPe Domain Sequences for d3giqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3giqa2 c.1.9.0 (A:61-418) automated matches {Bordetella bronchiseptica [TaxId: 518]}
gfidvhghddlmfvekpdlrwktsqgittvvvgncgvsaapaplpgntaaalallgetpl
fadvpayfaaldaqrpminvaalvghanlrlaamrdpqaaptaaeqqamqdmlqaaleag
avgfstglayqpgavaqaaeleglarvaaerrrlhtshirneadgveaaveevlaigrgt
gcatvvshhkcmmpqnwgrsratlanidrareqgvevaldiypypgsstiliperaetid
diritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfamdedevkrifqhpcc
mvgsdglpndarphprlwgsftrvlgryvrearlmtleqavarmtalparvfgfaerg

SCOPe Domain Coordinates for d3giqa2:

Click to download the PDB-style file with coordinates for d3giqa2.
(The format of our PDB-style files is described here.)

Timeline for d3giqa2: