SCOPe 2.08: Domain d1ihwa_: 1ihw A:

Lineage for d1ihwa_ (1ihw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families)

5. Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
   Pfam PF00552, Pfam PF18103

6. Protein DNA-binding domain of retroviral integrase [50124] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50125] (8 PDB entries)

8. Domain d1ihwa_: 1ihw A: [24631]

Details for d1ihwa_

PDB Entry: 1ihw

PDB Description: solution structure of the dna binding domain of hiv-1 integrase, nmr, 40 structures

PDB Compounds: (A:) hiv-1 integrase

SCOPe Domain Sequences for d1ihwa_:

Sequence; same for both SEQRES and ATOM records:

>d1ihwa_ b.34.7.1 (A:) DNA-binding domain of retroviral integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
miqnfrvyyrdsrdpvwkgpakllwkgegavviqdnsdikvvprrkakiird

Timeline for d1ihwa_:

• d1ihwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ihwa_ appears in SCOPe 2.07