Lineage for d3gipb2 (3gip B:61-418)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1820872Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1821491Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 1821492Protein automated matches [190150] (22 species)
    not a true protein
  7. 1821498Species Bordetella bronchiseptica [TaxId:518] [255848] (2 PDB entries)
  8. 1821500Domain d3gipb2: 3gip B:61-418 [246308]
    Other proteins in same PDB: d3gipa1, d3gipa3, d3gipb1, d3gipb3
    automated match to d1rk6a3
    complexed with acy, fmt, zn

Details for d3gipb2

PDB Entry: 3gip (more details), 1.5 Å

PDB Description: Crystal structure of N-acyl-D-Glutamate Deacylase from Bordetella Bronchiseptica complexed with zinc, acetate and formate ions.
PDB Compounds: (B:) N-acyl-D-glutamate deacylase

SCOPe Domain Sequences for d3gipb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gipb2 c.1.9.0 (B:61-418) automated matches {Bordetella bronchiseptica [TaxId: 518]}
gfidvhghddlmfvekpdlrwktsqgittvvvgncgvsaapaplpgntaaalallgetpl
fadvpayfaaldaqrpminvaalvghanlrlaamrdpqaaptaaeqqamqdmlqaaleag
avgfstglayqpgavaqaaeleglarvaaerrrlhtshirneadgveaaveevlaigrgt
gcatvvshhkcmmpqnwgrsratlanidrareqgvevaldiypypgsstiliperaetid
diritwstphpecsgeyladiaarwgcdkttaarrlapagaiyfamdedevkrifqhpcc
mvgsdglpndarphprlwgsftrvlgryvrearlmtleqavarmtalparvfgfaerg

SCOPe Domain Coordinates for d3gipb2:

Click to download the PDB-style file with coordinates for d3gipb2.
(The format of our PDB-style files is described here.)

Timeline for d3gipb2: