SCOPe 2.08: Domain d3gipb1: 3gip B:5-60

Lineage for d3gipb1 (3gip B:5-60)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.0: automated matches [254292] (1 protein)
   not a true family

6. Protein automated matches [254676] (1 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:518] [255847] (2 PDB entries)

8. Domain d3gipb1: 3gip B:5-60 [246307]
   Other proteins in same PDB: d3gipa2, d3gipb2
   automated match to d1rk6a1
   complexed with acy, fmt, zn

Details for d3gipb1

PDB Entry: 3gip, 1.5 Å

PDB Description: Crystal structure of N-acyl-D-Glutamate Deacylase from Bordetella Bronchiseptica complexed with zinc, acetate and formate ions.

PDB Compounds: (B:) N-acyl-D-glutamate deacylase

SCOPe Domain Sequences for d3gipb1:

Sequence; same for both SEQRES and ATOM records:

>d3gipb1 b.92.1.0 (B:5-60) automated matches {Bordetella bronchiseptica [TaxId: 518]}
ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivap

Timeline for d3gipb1:

• d3gipb1 first appeared in SCOPe 2.04
  
• d3gipb1 appears in SCOPe 2.07