Class b: All beta proteins [48724] (176 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.0: automated matches [254292] (1 protein) not a true family |
Protein automated matches [254676] (1 species) not a true protein |
Species Bordetella bronchiseptica [TaxId:518] [255847] (2 PDB entries) |
Domain d3gipa1: 3gip A:5-60 [246304] Other proteins in same PDB: d3gipa2, d3gipb2 automated match to d1rk6a1 complexed with acy, fmt, zn |
PDB Entry: 3gip (more details), 1.5 Å
SCOPe Domain Sequences for d3gipa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gipa1 b.92.1.0 (A:5-60) automated matches {Bordetella bronchiseptica [TaxId: 518]} ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivap
Timeline for d3gipa1: