![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
![]() | Protein Cellulosomal scaffoldin adaptor protein B, ScaB [110073] (1 species) |
![]() | Species Acetivibrio cellulolyticus [TaxId:35830] [110074] (8 PDB entries) Uniprot Q7WYN3 29-199 |
![]() | Domain d3ghpb_: 3ghp B: [246303] automated match to d3fnka_ complexed with edo |
PDB Entry: 3ghp (more details), 2.49 Å
SCOPe Domain Sequences for d3ghpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ghpb_ b.2.2.2 (B:) Cellulosomal scaffoldin adaptor protein B, ScaB {Acetivibrio cellulolyticus [TaxId: 35830]} mikasyitmgydknaaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvayt nsslptsgellvsedygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvgf kvlqkkattvvfedsetmpngitgttlfnwygnriqsgyfviqpgeinsapiatatpttk pta
Timeline for d3ghpb_: