Lineage for d3ghgj_ (3ghg J:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1708774Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 1708937Family h.1.8.0: automated matches [254291] (1 protein)
    not a true family
  6. 1708938Protein automated matches [254675] (1 species)
    not a true protein
  7. 1708939Species Human (Homo sapiens) [TaxId:9606] [255846] (1 PDB entry)
  8. 1708943Domain d3ghgj_: 3ghg J: [246302]
    automated match to d1m1jd_
    complexed with ca

Details for d3ghgj_

PDB Entry: 3ghg (more details), 2.9 Å

PDB Description: crystal structure of human fibrinogen
PDB Compounds: (J:) fibrinogen alpha chain

SCOPe Domain Sequences for d3ghgj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ghgj_ h.1.8.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ackdsdwpfcsdedwnykcpsgcrmkglidevnqdftnrinklknslfeyqknnkdshsl
ttnimeilrgdfssannrdntynrvsedlrsrievlkrkviekvqhiqllqknvraqlvd
mkrlevdidikirscrgscsralarevdlkdyedqqkqleqviakdllpsrdrqhlplik
mkpvpd

SCOPe Domain Coordinates for d3ghgj_:

Click to download the PDB-style file with coordinates for d3ghgj_.
(The format of our PDB-style files is described here.)

Timeline for d3ghgj_: