![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) ![]() |
![]() | Family h.1.8.0: automated matches [254291] (1 protein) not a true family |
![]() | Protein automated matches [254675] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255846] (1 PDB entry) |
![]() | Domain d3ghgg_: 3ghg G: [246301] automated match to d1m1jd_ complexed with ca |
PDB Entry: 3ghg (more details), 2.9 Å
SCOPe Domain Sequences for d3ghgg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ghgg_ h.1.8.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ackdsdwpfcsdedwnykcpsgcrmkglidevnqdftnrinklknslfeyqknnkdshsl ttnimeilrgdfssannrdntynrvsedlrsrievlkrkviekvqhiqllqknvraqlvd mkrlevdidikirscrgscsralarevdlkdyedqqkqleqviakdllpsrdrq
Timeline for d3ghgg_: