Lineage for d1ihva_ (1ihv A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13313Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (1 family) (S)
  5. 13314Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
  6. 13315Protein DNA-binding domain of retroviral integrase [50124] (3 species)
  7. 13316Species Human immunodeficiency virus type 1 [TaxId:11676] [50125] (4 PDB entries)
  8. 13319Domain d1ihva_: 1ihv A: [24629]

Details for d1ihva_

PDB Entry: 1ihv (more details)

PDB Description: solution structure of the dna binding domain of hiv-1 integrase, nmr, minimized average structure

SCOP Domain Sequences for d1ihva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihva_ b.34.7.1 (A:) DNA-binding domain of retroviral integrase {Human immunodeficiency virus type 1}
miqnfrvyyrdsrdpvwkgpakllwkgegavviqdnsdikvvprrkakiird

SCOP Domain Coordinates for d1ihva_:

Click to download the PDB-style file with coordinates for d1ihva_.
(The format of our PDB-style files is described here.)

Timeline for d1ihva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ihvb_