SCOPe 2.06: Domain d3gfqb_: 3gfq B:

Lineage for d3gfqb_ (3gfq B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins)
   Pfam PF03358

6. Protein automated matches [190892] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189046] (3 PDB entries)

8. Domain d3gfqb_: 3gfq B: [246287]
   automated match to d3gfrd_
   complexed with fmn

Details for d3gfqb_

PDB Entry: 3gfq, 3 Å

PDB Description: structure of yhda, k109l variant

PDB Compounds: (B:) FMN-dependent NADPH-azoreductase

SCOPe Domain Sequences for d3gfqb_:

Sequence; same for both SEQRES and ATOM records:

>d3gfqb_ c.23.5.4 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
kadaivllspeyhsgmsgalknaldflsseqfkykpvallavaggglgginalnnmrtvm
rgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfaka

Timeline for d3gfqb_:

• d3gfqb_ first appeared in SCOPe 2.04
  
• d3gfqb_ appears in SCOPe 2.05
  
• d3gfqb_ appears in SCOPe 2.07
  
• d3gfqb_ appears in the current release, SCOPe 2.08