Lineage for d3gfoa_ (3gfo A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849762Species Clostridium perfringens [TaxId:195103] [255845] (1 PDB entry)
  8. 1849763Domain d3gfoa_: 3gfo A: [246284]
    automated match to d1ji0a_
    complexed with so4

Details for d3gfoa_

PDB Entry: 3gfo (more details), 2.3 Å

PDB Description: structure of cbio1 from clostridium perfringens: part of the abc transporter complex cbionq.
PDB Compounds: (A:) Cobalt import ATP-binding protein cbiO 1

SCOPe Domain Sequences for d3gfoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gfoa_ c.37.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 195103]}
edyilkveelnynysdgthalkginmnikrgevtailggngvgkstlfqnfngilkpssg
rilfdnkpidysrkgimklresigivfqdpdnqlfsasvyqdvsfgavnmklpedeirkr
vdnalkrtgiehlkdkpthclsfgqkkrvaiagvlvmepkvlildeptagldpmgvseim
kllvemqkelgitiiiathdidivplycdnvfvmkegrvilqgnpkevfaekevirkvnl
rlprighlmei

SCOPe Domain Coordinates for d3gfoa_:

Click to download the PDB-style file with coordinates for d3gfoa_.
(The format of our PDB-style files is described here.)

Timeline for d3gfoa_: