SCOPe 2.04: Domain d3gdxa1: 3gdx A:10-91

Lineage for d3gdxa1 (3gdx A:10-91)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (143 PDB entries)
   Uniprot P06746

8. Domain d3gdxa1: 3gdx A:10-91 [246281]
   Other proteins in same PDB: d3gdxa2, d3gdxa3
   automated match to d1tv9a1
   protein/DNA complex; complexed with 4bd, cl, mg, na

Details for d3gdxa1

PDB Entry: 3gdx, 2.2 Å

PDB Description: Dna polymerase beta with a gapped DND substrate and dTMP(CF2)PP

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3gdxa1:

Sequence; same for both SEQRES and ATOM records:

>d3gdxa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

Timeline for d3gdxa1:

• d3gdxa1 is new in SCOPe 2.04-stable
  
• d3gdxa1 appears in SCOPe 2.05
  
• d3gdxa1 appears in the current release, SCOPe 2.08