Lineage for d1ex4b1 (1ex4 B:223-270)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784433Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) (S)
  5. 2784434Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
    Pfam PF00552, Pfam PF18103
  6. 2784435Protein DNA-binding domain of retroviral integrase [50124] (4 species)
  7. 2784436Species Human immunodeficiency virus type 1 [TaxId:11676] [50125] (8 PDB entries)
  8. 2784445Domain d1ex4b1: 1ex4 B:223-270 [24628]
    Other proteins in same PDB: d1ex4a2, d1ex4b2
    complexed with cps

Details for d1ex4b1

PDB Entry: 1ex4 (more details), 2.8 Å

PDB Description: hiv-1 integrase catalytic core and c-terminal domain
PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d1ex4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ex4b1 b.34.7.1 (B:223-270) DNA-binding domain of retroviral integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
frvyyrdsrnslwkgpakllwkgegavviqdnsdikvvprrkakiird

SCOPe Domain Coordinates for d1ex4b1:

Click to download the PDB-style file with coordinates for d1ex4b1.
(The format of our PDB-style files is described here.)

Timeline for d1ex4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ex4b2