Lineage for d3gb8b2 (3gb8 B:1-66)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1968131Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies)
    not a true fold
  4. 1968137Superfamily g.88.2: importin-beta binding (IBB) domain of snurportin-1 [254134] (2 families) (S)
  5. 1968138Family g.88.2.1: importin-beta binding (IBB) domain of snurportin-1 [254172] (1 protein)
    Pfam PF11538; PubMed 18187419
  6. 1968139Protein importin-beta binding (IBB) domain of snurportin-1 [254389] (1 species)
  7. 1968140Species Human (Homo sapiens) [TaxId:9606] [254822] (3 PDB entries)
  8. 1968142Domain d3gb8b2: 3gb8 B:1-66 [246278]
    Other proteins in same PDB: d3gb8a_, d3gb8b1
    protein/RNA complex

Details for d3gb8b2

PDB Entry: 3gb8 (more details), 2.9 Å

PDB Description: crystal structure of crm1/snurportin-1 complex
PDB Compounds: (B:) Snurportin-1

SCOPe Domain Sequences for d3gb8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gb8b2 g.88.2.1 (B:1-66) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]}
meelsqalassfsvsqdlnstaaphprlsqykskyssleqserrrrllelqkskrldyvn
harrla

SCOPe Domain Coordinates for d3gb8b2:

Click to download the PDB-style file with coordinates for d3gb8b2.
(The format of our PDB-style files is described here.)

Timeline for d3gb8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gb8b1
View in 3D
Domains from other chains:
(mouse over for more information)
d3gb8a_