Class g: Small proteins [56992] (100 folds) |
Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily g.88.2: importin-beta binding (IBB) domain of snurportin-1 [254134] (2 families) |
Family g.88.2.1: importin-beta binding (IBB) domain of snurportin-1 [254172] (1 protein) Pfam PF11538; PubMed 18187419 |
Protein importin-beta binding (IBB) domain of snurportin-1 [254389] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254822] (3 PDB entries) |
Domain d3gb8b2: 3gb8 B:1-66 [246278] Other proteins in same PDB: d3gb8a_, d3gb8b1, d3gb8b3 protein/RNA complex has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3gb8 (more details), 2.9 Å
SCOPe Domain Sequences for d3gb8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gb8b2 g.88.2.1 (B:1-66) importin-beta binding (IBB) domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]} meelsqalassfsvsqdlnstaaphprlsqykskyssleqserrrrllelqkskrldyvn harrla
Timeline for d3gb8b2: