Lineage for d3gb8b1 (3gb8 B:94-294)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2979301Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2979373Family d.142.2.5: m3G-cap binding domain of snurportin-1 [254171] (2 proteins)
  6. 2979374Protein m3G-cap binding domain of snurportin-1 [254388] (1 species)
  7. 2979375Species Human (Homo sapiens) [TaxId:9606] [254821] (2 PDB entries)
  8. 2979377Domain d3gb8b1: 3gb8 B:94-294 [246277]
    Other proteins in same PDB: d3gb8a_, d3gb8b2, d3gb8b3
    protein/RNA complex

Details for d3gb8b1

PDB Entry: 3gb8 (more details), 2.9 Å

PDB Description: crystal structure of crm1/snurportin-1 complex
PDB Compounds: (B:) Snurportin-1

SCOPe Domain Sequences for d3gb8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gb8b1 d.142.2.5 (B:94-294) m3G-cap binding domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]}
lpkhyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgstsaytksgycvnrfs
sllpggnrrnstakdytildciynevnqtyyvldvmcwrghpfydcqtdfrfywmhsklp
eeeglgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkqthyspgstpl
vgwlrpymvsdvlgvavpagp

SCOPe Domain Coordinates for d3gb8b1:

Click to download the PDB-style file with coordinates for d3gb8b1.
(The format of our PDB-style files is described here.)

Timeline for d3gb8b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gb8a_