Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) has a circularly permuted topology |
Family d.142.2.5: m3G-cap binding domain of snurportin-1 [254171] (2 proteins) |
Protein m3G-cap binding domain of snurportin-1 [254388] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254821] (2 PDB entries) |
Domain d3gb8b1: 3gb8 B:94-294 [246277] Other proteins in same PDB: d3gb8a_, d3gb8b2, d3gb8b3 protein/RNA complex |
PDB Entry: 3gb8 (more details), 2.9 Å
SCOPe Domain Sequences for d3gb8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gb8b1 d.142.2.5 (B:94-294) m3G-cap binding domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]} lpkhyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgstsaytksgycvnrfs sllpggnrrnstakdytildciynevnqtyyvldvmcwrghpfydcqtdfrfywmhsklp eeeglgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkqthyspgstpl vgwlrpymvsdvlgvavpagp
Timeline for d3gb8b1: