Lineage for d3gb8a_ (3gb8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006820Family a.118.1.19: Exportin HEAT-like repeat [117002] (2 protein domains)
    Pfam PF08389, Pfam PF08767; full length proteins have several extra helices at C-terminus
  6. 2006821Protein Exportin-1 (Xpo1, Crm1) [117003] (1 species)
  7. 2006822Species Human (Homo sapiens) [TaxId:9606] [117004] (2 PDB entries)
    Uniprot O14980 707-1027
  8. 2006825Domain d3gb8a_: 3gb8 A: [246276]
    Other proteins in same PDB: d3gb8b1, d3gb8b2, d3gb8b3
    protein/RNA complex

Details for d3gb8a_

PDB Entry: 3gb8 (more details), 2.9 Å

PDB Description: crystal structure of crm1/snurportin-1 complex
PDB Compounds: (A:) Exportin-1

SCOPe Domain Sequences for d3gb8a_:

Sequence, based on SEQRES records: (download)

>d3gb8a_ a.118.1.19 (A:) Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [TaxId: 9606]}
lkehpdawtrvdtilefsqnmntkyyglqilenviktrwkilprnqcegikkyvvgliik
tssdptcvekekvyigklnmilvqilkqewpkhwptfisdivgasrtseslcqnnmvilk
llseevfdfssgqitqvkskhlkdsmcnefsqifqlcqfvmensqnaplvhatletllrf
lnwiplgyifetklistliykflnvpmfrnvslkclteiagvsvsqyeeqfvtlftltmm
qlkqmlplntnirlaysngkddeqnfiqnlslflctflkehdqliekrlnlretlmealh
ymllvseveeteifkicleywnhlaaelyrespfstsaspllsgsqhfdvpprrqlylpm
lfkvrllmvsrmakpeevlvvendqgevvrefmkdtdsinlyknmretlvylthldyvdt
erimteklhnqvngtewswknlntlcwaigsisgamheedekrflvtvikdllglceqkr
gkdnkaiiasnimyivgqyprflrahwkflktvvnklfefmhethdgvqdmacdtfikia
qkcrrhfvqvqvgevmpfideilnnintiicdlqpqqvhtfyeavgymigaqtdqtvqeh
liekymllpnqvwdsiiqqatknvdilkdpetvkqlgsilktnvrackavghpfviqlgr
iyldmlnvykclsenisaaiqangemvtkqplirsmrtvkretlklisgwvsrsndpqmv
aenfvpplldavlidyqrnvpaarepevlstmaiivnklgghitaeipqifdavfectln
minkdfeeypehrtnfflllqavnshcfpaflaipptqfklvldsiiwafkhtmrnvadt
glqilftllqnvaqeeaaaqsfyqtyfcdilqhifsvvtdtshtagltmhasilaymfnl
veegkistslnpgnpvnnqiflqeyvanllksafphlqdaqvklfvtglfslnqdipafk
ehlrdflvqikefagedtsdlfleereialrqadeekhkrqmsvpgifnp

Sequence, based on observed residues (ATOM records): (download)

>d3gb8a_ a.118.1.19 (A:) Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [TaxId: 9606]}
lkehprvdtilefsqnmntkyyglqilenviktrwrnqcegikkyvvgliiktssekekv
yigklnmilvqilkqewpkhwptfisdivgasrtseslcqnnmvilkllseevftqvksk
hlkdsmcnefsqifqlcqfvmensqnaplvhatletllrflnwiplgyifetklistliy
kflnvpmfrnvslkclteiagvsvsqyeeqfvtlftltmmqlkqmlplntnirlaysngk
ddeqnfiqnlslflctflkehdqliekrlnlretlmealhymllvseveeteifkicley
wnhlaaelyrespfsvpprrqlylpmlfkvrllmvsrmakpeedtdsinlyknmretlvy
lthldyvdterimteklhnqvngtewswknlntlcwaigsisgamheedekrflvtvikd
llglceqkrgkdnkaiiasnimyivgqyprflrahwkflktvvnklfefmhethdgvqdm
acdtfikiaqkcrrhfvqvqvgevmpfideilnnintiicdlqpqqvhtfyeavgymiga
qtdqtvqehliekymllpnqvwdsiiqqatknvdilkdpetvkqlgsilktnvrackavg
hpfviqlgriyldmlnvykclsenisaaiqangemvtkqplirsmrtvkretlklisgwv
srsndpqmvaenfvpplldavlidyqrnvpaarepevlstmaiivnklgghitaeipqif
davfectlnminkdfeeypehrtnfflllqavnshcfpaflaipptqfklvldsiiwafk
htmrnvadtglqilftllqnvaqeeaaaqsfyqtyfcdilqhifsvvtdtshtagltmha
silaymfnlveegkistslnpgnpvnnqiflqeyvanllksafphlqdaqvklfvtglfs
lnqdipafkehlrdflvqikefagedtsdlfleereialrqadeekhkrqmsvpgifnp

SCOPe Domain Coordinates for d3gb8a_:

Click to download the PDB-style file with coordinates for d3gb8a_.
(The format of our PDB-style files is described here.)

Timeline for d3gb8a_: